PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009626580.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NF-YA
Protein Properties Length: 309aa    MW: 34319.1 Da    PI: 8.453
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009626580.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA100.12.2e-31152208158
       CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                     +ep++VNaKQy++Il+RRq Rak+e ekk  +k+rkpylheSRh+hA+rR+Rg+gGrF
  XP_009626580.1 152 EEPVFVNAKQYHGILRRRQIRAKAELEKKA-IKARKPYLHESRHQHAMRRARGTGGRF 208
                     69***************************9.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.1E-36150211IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.628151211IPR001289Nuclear transcription factor Y subunit A
PfamPF020455.9E-27153208IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006167.1E-24154176IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860156176IPR018362CCAAT-binding factor, conserved site
PRINTSPR006167.1E-24185208IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MSFDICPSWI APIIQLCELE TGLRMTSQST TQMQPWWQGY GDNTMSLVSE NTVAQGNAEG  60
GNEEKETNAQ ATESGSKGNN VQYKQHLKHI TSTTVTIMGE QQKELTGHSA MLTSYPYPDL  120
QYGGMMTYGA PVHPHLFEIH HARMPLPLDM EEEPVFVNAK QYHGILRRRQ IRAKAELEKK  180
AIKARKPYLH ESRHQHAMRR ARGTGGRFLN TKKLNDMDCI TDEAKKYGAT IPTHSGNSSG  240
SGSSDQREKE GSTVQDMHKG QRSFSTGNGH GSSVYFSQYA GNEQQNGHYS HGSWSLLVSQ  300
ASRGAASNN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A6e-20152212262NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754401e-106HG975440.1 Solanum pennellii chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009626580.10.0PREDICTED: nuclear transcription factor Y subunit A-1-like isoform X1
TrEMBLM1A9B51e-175M1A9B5_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000176981e-174(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA112322025
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G30500.13e-29nuclear factor Y, subunit A7